Биологическое образование в МФТИ
Rambler's Top100
Физтех-ПорталСайт ФМХФСайт ФБМФРасписание экзаменовЭлектричкиФорум ФМБФ
 Поиск
 Разделы сайта

 Голосование
На ваш взгляд, какой из способов является оптимальным для обеспечения безопасности студентов?

Заняться единоборствами
Патрули полиции и ДНД
Ношение личного оружия
Гулять вместе с друзьями
Нанять телохранителей
Просто быть бдительными
Научиться быстро бегать
Не носить дорогих вещей
Другое

Результаты
Архив голосований
 Материалы сервера
Версия для печати
Опубликовано: 04.04.2008

Лекция №3. Наследование групп крови, резус-фактор. Молекулярные машины.


План нашей лекции:

  1. Результаты опроса
  2. Наследование групп крови Rh.
  3. Программа курса.
  4. Молекулярные машины.

Данный курс для неспециалистов, курс общей биологии является экспериментальным. Может возникнуть вопрос, зачем ходить на лекции, если все можно прочитать в каких-нибудь учебниках. Стоит отметить, что на лекциях вы получаете определенную точку зрения специалиста в своей области. Существует легенда об Эйнштейне, что, начиная курс своих лекций, он предупреждал студентов, чтобы они не забывали, что то, что он преподает, - это его собственное мнение, его представление о явлениях природы. То есть не истина, как она есть, а то, как он ее себе представляет. То, что мы будем представлять в данном курсе, это также наше мнение, по разным вопросам биологии, касающихся разных аспектов живой природы. Оно основано на разных методах исследований, современных концепциях, определенных правилах получения знаний. Есть разные методы познания. Например, в древности на Востоке для получения истины люди медитировали, а затем, познав истину, рассказывали другим, что они узнали. Научный метод познания - другой, особенно, в таких науках как биология, физика. Он основан на экспериментах, на проверке различных гипотез. Мы будем говорить о том, каким именно образом были получены факты, на которых основаны современные биологические концепции. Мы будем рассказывать не об устройстве природы, а о моделях устройства природы, построенных в разное время, разными учеными, на основе различных экспериментов и гипотез, которые в этих экспериментах проверялись.

Результаты опроса.

Для построения курса важна обратная связь с аудиторией. Поэтому анкеты, которые заполнялись слушателями на двух предыдущих лекциях, помогли нам составить представление об общем уровне аудитории. Данные были обработаны, и были получены следующие результаты.

Итак, на прошлой лекции было получено 62 анкеты. Было задано 4 вопроса:

  1. Узнали ли вы что-нибудь новое?
  2. Реструктурировали ли вы уже имеющиеся знания?
  3. Оцените уровень сложности лекции для Вас.
  4. Комментарии и пожелания, если имеются.

На первый вопрос 44 человека ответили положительно, т.е. приблизительно 70% слушателей вынесли для себя что-то новое из предыдущей лекции. 17 человек (28%) ничего нового не услышали, и один человек не ответил (диаграмма на рисунке слева; красным на диаграммах выделены отрицательные ответы, зеленым - положительные, желтым – неопределенные).

Результаты опроса

На диаграмме, изображенной справа представлено распределение ответов на второй вопрос. Положительно ответили 34 человека (55%), 23 человека (37%) не реструктурировали имеющиеся знания, и 5 (8%) не ответили либо ответили что-то неопределенное. Учитывая, что в аудитории около 100 человек, то мнение приблизительно сорока человек, не сдавших анкеты, не могло быть учтено.

В четвертом пункте анкеты были получены следующие комментарии. 19 человек оценили лекцию как «интересную, очень интересную, всегда бы так». Было много ценных замечаний по поводу проведения лекции, в частности, была просьба писать план на доске. Примерно треть отвечавших на вопросы оценили лекцию положительно. Среди же тех, кто ничего нового на лекциях не узнал, ничего не реструктурировал, двое написали, что им было интересно. Остальные четверо из этой группы написали, что интересно им не было. Этому может быть два объяснения: либо они все, что звучало, уже знают, либо они ничего не знают, поэтому ничего получить не могли. Время покажет, какой из этих вариантов более правдоподобен, а при изложении лекции я попытаюсь учесть возможность обоих этих вариантов. Запомнился один комментарий: «В эволюцию я не верю! Было интересно». Я в эволюцию тоже не верю, ровно как мне не нужно верить в то, что у всех присутствующих здесь есть два уха, - я это просто вижу. Я не прошу вас верить в эволюцию, это не предмет веры. Слушайте, делайте свои выводы, я вам пытаюсь рассказывать об экспериментах и различных концепциях.

Уровень сложности был оценен следующим образом. Два человека сказали, что уровень сложный, 45 оценили его как доступный, и 15 сказали, что уровень сложности можно повысить. На наш взгляд, это довольно неплохое попадание. Уровень сложности сегодняшней лекции немного выше.

Наследование групп крови резус

После первой лекции был проведен опрос с целью выявить интересы аудитории, определить общий уровень подготовки; в ходе его был задан вопрос о наследовании группы крови резус. Мы получили 56 анкет, 22 человека ответили на вопрос верно, 34 ответа были неверными либо просто отсутствовали. Следует отметить, что вопрос довольно простой, не выходящий за рамки школьной программы по биологии. Даже если не изучались конкретно группы крови резус, но в курсе общей биологии шла речь о доминантных и рецессивных признаках, и можно было догадаться, как ответить на этот вопрос. Так как половина аудитории на этот вопрос не могла ответить, сейчас мы этот вопрос разберем.

Группа крови человека определяется при смешении капли его крови с антителами к данному белку. В эритроцитах на мембране находятся белки. Они как бы пронизывают мембрану. Один из этих белков называется резус. На рисунке представлено положение резус белка резус в мембране эритроцитов.

Положение белка резус в мембране эритроцитов

Почему он так назван? В 30-40-х годах, когда довольно интенсивно проводились исследования групп крови, было обнаружено, что антитела к группе крови мартышки резус агглютинируют у некоторых людей их эритроциты.

Агглютинация – это процесс склеивания эритроцитов под действием антител к белам, расположенным на мембранах эритроцитов. На рисунке ниже представлен картина агглютинации. Здесь изображены капельки крови , к которым добавлена сыворотка, содержащая антитела к резус-белку. Синим обведены капли, в которых с кровью ничего не происходит. Если реакция при добавлении антител не идет, то, значит у данного человека резус-белок отсутствует. Красным обведены образцы крови, в которых происходит агглютинация. Буквами помечены капли крови, которые реакцию дают, но очень слабую. Такое встречается у приблизительно 1% людей, и это так и называемый слабый резус фенотип.

Метод определения резус-группы крови

С чем это связано? На рисунке ниже буквами представлена последовательность резус-белка. Вы знаете, что белок состоит из 20 аминокислот, каждая из которых обозначается своей буквой. Ген (последовательность нуклеотидов, соответственно, в 3 раза более длинная последовательность, записанная только четыремя буквами, а не 20), который кодирует резус-белок, называется RHD.

 

АМИНОКИСЛОТНАЯ ПОСЛЕДОВАТЕЛЬНОСТЬ РЕЗУС-БЕЛКА ЧЕЛОВЕКА

(каждая аминокислота обозначена одной буквой):

Информация из базы данных NCBI

Human RhD blood group antigen mRNA, complete cds

ORGANISM Homo sapiens

standard_name="RhD"

 

MSSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQV

GQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALGVQWAILLDGFLSQ

FP SGKVVITLFSIRLATMSALSVLISVDAVLGKVNLAQLVVMVLVEVTA

LGNLRMVISNIFNTDYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKD

QTATIPSLSAMLGALFLWMFWPSFNSALLRSPIERKNAVFNTYYAVAVSV

VTAISGSSLAHPQGKISKTYVHSAVLAGGVAVGTSCHLIPSPWLAMVLGL

VAGLISVGGAKYLPGCCNRVLGIPHSSIMGYNFSLLGLLGEIIYIVLLVL

DTVGAGNGMIGFQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHEA

KYFDDQVFWKFPHLAVGF

 

ПОСЛЕДОВАТЕЛЬНОСТЬ НУКЛЕОТИДОВ КОДИРУЮЩЕЙ ЧАСТИ ГЕНА РЕЗУС-БЕЛКА ЧЕЛОВЕКА

Информация из базы данных NCBI

1

atgagctcta

agtacccgcg

gtctgtccgg

cgctgcctgc

ccctctgggc

cctaacactg

61

gaagcagctc

tcattctcct

cttctatttt

tttacccact

atgacgcttc

cttagaggat

121

caaaaggggc

tcgtggcatc

ctatcaagtt

ggccaagatc

tgaccgtgat

ggcggccatt

181

ggcttgggct

tcctcacctc

gagtttccgg

agacacagct

ggagcagtgt

ggccttcaac

241

ctcttcatgc

tggcgcttgg

tgtgcagtgg

gcaatcctgc

tggacggctt

cctgagccag

301

ttcccttctg

ggaaggtggt

catcacactg

ttcagtattc

ggctggccac

catgagtgct

361

ttgtcggtgc

tgatctcagt

ggatgctgtc

ttggggaagg

tcaacttggc

gcagttggtg

421

gtgatggtgc

tggtggaggt

gacagcttta

ggcaacctga

ggatggtcat

cagtaatatc

481

ttcaacacag

actaccacat

gaacatgatg

cacatctacg

tgttcgcagc

ctattttggg

541

ctgtctgtgg

cctggtgcct

gccaaagcct

ctacccgagg

gaacggagga

taaagatcag

601

acagcaacga

tacccagttt

gtctgccatg

ctgggcgccc

tcttcttgtg

gatgttctgg

661

ccaagtttca

actctgctct

gctgagaagt

ccaatcgaaa

ggaagaatgc

cgtgttcaac

721

acctactatg

ctgtagcagt

cagcgtggtg

acagccatct

cagggtcatc

cttggctcac

781

ccccaaggga

agatcagcaa

gacttatgtg

cacagtgcgg

tgttggcagg

aggcgtggct

841

gtgggtacct

cgtgtcacct

gatcccttct

ccgtggcttg

ccatggtgct

gggtcttgtg

901

gctgggctga

tctccgtcgg

gggagccaag

tacctgccgg

ggtgttgtaa

ccgagtgctg

961

gggattcccc

acagctccat

catgggctac

aacttcagct

tgctgggtct

gcttggagag

1021

atcatctaca

ttgtgttgct

ggtgcttgat

accgtcggag

ccggcaatgg

catgattggc

1081

ttccaggtcc

tcctcagcat

tggggaactc

agcttggcca

tcgtgatagc

tctcacgtct

1141

ggtctcctga

caggtttgct

cctaaatctt

aaaatatgga

aagcacctca

tgaggctaaa

1201

tattttgatg

accaagtttt

ctggaagttt

cctcatttgg

ctgttggatt

ttaagcaaaa

1261

gcatccaaga

aaaacaaggc

ctgttcaaaa

acaagacaac

ttcctctcac

tgttgcctgc

1321

atttgtacgt

gagaaacgct

catgacagca

aagt//

 

 

У большинства людей (85%) имеется ген резус-фактора, но у 15% этот ген отсутствует, отсутствует соответствующий гену нуклеотидный "текст" . Если этот ген присутствует, то он определяет у человека синтез резус-белка. Если же его нет, то резус-белок не синтезируется.

Такие разные "состояния" гена – вариации нуклеотидного "текста" называются альтернативными формами или коротко –аллелями. В данном случае вариация – это наличие или отсутствие всей нуклеотидной последовательности гена.

У человека может встречаться 3 варианта сочетания резус-аллелей. Человек, у которого 2 аллеля с присутствующим геном, имеет группу крови резус положительную (рис. 4 вверху). Если у человека на одной из хромосом ген отсутствует, то белок все равно синтезируется с гена на другой хромосоме; и резус-группа также положительная (рис. в середине). Белок не синтезируется только в том случае, когда ген отсутствует на обоих хромосомах. Только в этом случае группа крови резус-отрицательная (рис. 4 внизу).

Ген RHD, наличие которого определяет тип группы  крови

Вопрос, который был задан, описывал ситуацию, когда оба родителя имеют два разных аллеля. То есть оба они резус-положительны, но второй аллель у них не содержит последовательность, кодирующую резус-белок. И оба их ребенка получили от каждого из родителей как раз этот аллель с отсутствующим геном. Несложно рассчитать вероятность рождения в такой семье ребенка с отрицательным резус-фактором. Она равна 25% (1/2*1/2=1/4); вероятность же рождения обоих детей с резус-отрицательной группой крови – 1/16.

Стоит упомянуть о резус-конфликте. Его суть заключается в следующем. Если мать резус-отрицательна, ее муж резус-положительный, и ребенок наследует от отца Rh+, то в крови матери могут начать вырабатываться антитела против резус-фактора плода. При первой беременности этого обычно не происходит, но при родах возможен контакт с белками крови ребенка, и у матери могут появиться в крови антитела к резус-фактору. Тогда при следующей беременности резус-положительным плодом материнские антитела разрушат эритроциты ребенка. Это заболевание называется гемолитическая желтуха (ребенок рождается весь желтый и обычно вскоре умирает). Описано это заболевание впервые в 1609 году французской акушеркой. Когда была разработана процедура переливания крови, то таких детей научились спасать. Им делали заменное переливание крови, т.е. полностью сливали всю их кровь, и вводили новую. Теперь, когда установлены причины резус-конфликта, поступают следующим образом. Если во время беременности, у женщины кровь резус-отрицательна, а у мужа резус-положительна, следят за уровнем антител к резус-фактору и проводят необходимое лечение, если титр этих антител начинает возрастать. Стоит отметить, что если мать резус-положительна, а сам ребенок резус-отрицателен, то конфликта не происходит.

Я бы хотела отметить один из полученных ответов на этот вопрос. Когда мы составляли вопросы для лекций, мы получили реальный вопрос из газеты «АиФ» с просьбой разъяснить, в чем дело. Мы решили включить этот вопрос в опросник, с целью проверить, насколько наши слушателе знакомы с генетикой. Собственно, вопрос предполагался как чисто учебный. И вот один из ответов был следующим: «Я бы не рискнул отвечать на этот вопрос, так как я не специалист, а от моего ответа зависит семейное счастье человека». Хочется выразить уважение человеку, который так ответил на вопрос, потому что он воспринял контекст, в котором стояла чисто учебная задача. Он продемонстрировал понимание этических аспектов, связанных с наукой. Я думаю, вы понимаете, что существует ответственность ученого, и замечательно, что в вашей аудитории есть люди, которые уже сейчас настолько ясно понимают связь науки с реальной жизнью.

Молекулярные машины.

Обычно курс биологии строится от изучения простого, составных частей, к все более сложному. Сначала изучают химический состав клеток; потом ДНК, РНК, белок; затем строение клетки.

Но начать мы решили с чего-то более близкого к человеку с физическим образованием. Честно говоря, когда я изучала биологию, эта тема меня просто поразила, она мне показалось одной из наиболее интересных. Поэтому я решила вас не томить, не откладывать такую интересную тему на потом, а начать наш курс с рассмотрения работы молекулярных машин. Сегодня мы рассмотрим некоторые молекулярные машины. Первая из них называется АТФ-синтаза. Она занимается в митохондриях синтезом аденозинтрифосфорной кислоты (АТФ). Напомню, что АТФ – это молекула, которая обеспечивает клетку энергией (рис. 5).

Химическая формула аденозинтрифосфорной кислоты (АТФ)

Для нас сейчас важно, зато молекула аденозинтрифосфорной кислоты содержит так называемую макроэргическую связь. Реакция синтеза представлена на схеме.

АДФ+Ф ==> АТФ +H2O

Из аденозиндифосфата и фосфата получается АТФ, при этом образуется так называемая макроэргическая связь, и на ее образование затрачивается 30,6 кДж/моль (7,3 ккал/моль). АТФ обеспечивает энергией большинство происходящих в клетке процессов, так как при гидролизе макроэргической связи запасенная в ней энергия освобождается.

Как же синтезируется эта молекула, то есть, как образуется макроэргическая связь между фосфатами? Это было одно время загадкой. Существовало предположение о том, что есть какое-то вещество Х, химический посредник, осуществляет связь между процессами, дающими энергию, то есть окислением питательных веществ до СО2 и Н2О, и каким –то образом энергия окисления (в своем роде медленное "горение" внутри организма) переходит в энергию макроэргической связи в молекуле АТФ. Это предположение о наличии химического посредника, которого никто найти не мог, называлось гипотезой химического сопряжения (рис. 6).

Но в 1961 г. английский ученый Питер Митчелл предложил другое объяснение – хемиосмотическую гипотезу (подробнее мы о ней будем говорить позже), которая заключается в том, что вода, которая образуется в процессе окисления, образуется не в виде молекулы воды, а виде протона H+ и иона гидроксила OH. Энергия, получаемая при окислении, идет на то, чтобы продукты реакции – протон и гидроксил – разделить в пространстве. Протон выбрасывается из митохондрий через внутреннюю мембрану в межмембранное пространство (сам по себе протон не может проникнуть через мембрану митохондрии, эта мембрана непроницаема для заряженных частиц), и гидроксогруппы, которая остается внутри митохондрии.

Питер Д. Митчелл (Piter D. Mitchell) - нобелевский лауреат,  автор хемиосмотической гипотезы

В результате возникает разница концентраций ионов водорода (∆рН – то есть кислотности среды) и разница потенциала: положительные заряды снаружи митохондриальной мембраны, а отрицательный внутри. Напомним, что у митохондрий 2 мембраны, причем внешняя в энергетических процессах такой важной роли, как внутренняя, не играет. То есть энергия, полученная при окислении, запасена в виде электрохимической энергии. Электрический потенциал на мембране митохондрий достигает 200 милливольт, а толщина мембраны не превышает 10 нм.

Питер Митчелл первый высказал предположение о том, что химические реакции в клетке пространственно упорядочены, и продукты реакции распределяются асимметрично: протон в одну сторону, гидроксил в другую. За счет этого появляется электрохимический потенциал на мембране (обозначается Δμн). Он состоит из химической (∆рН – разница в концентрации протонов) и электрической (Δφ – разница в величине заряда) компоненты Δμн=∆рН + Δφ. Электрохимический потенциал на мембране митохондрий – универсальная форма запасания энергии клеткой.

Протоны могут перекачиваться через мембрану и при фотосинтезе в хлоропластах или в клетках фотосинтезирующих бактерий (Рис. 8).

Система бактериального фотосинтеза

На рисунке представлена довольно простая система бактериального фотосинтеза, сопряженного с синтезом АТФ на примере галобактерий. Галобактерии живут в Мертвом море. Море настолько соленое, что соль выпадает в осадок, но в таких экстремальных условиях галобактерии прекрасно себя чувствуют. Галобактерии используют фотосинтез для получения энергии. Белок бактериородопсин под действием света выкачивает протоны изнутри бактериальной клетки наружу, и на мембране снаружи избыток протонов, и, соответственно, образуется положительный заряд. То есть в данном случае электрохимический потенциал на мембране бактерии возникает не за счет окисления веществ в процессе дыхания, а за счет работы, связанной со световой энергией.

Если протон "падает" сквозь мембрану внутрь митохондрии, при этом его потенциальная энергия уменьшается, так как он "падает" в электрическом поле от положительного заряда к отрицательному, и вдобавок по градиенту концентрации. Эта энергия используется для синтеза АТФ. И далее пойдет речь о том, как это происходит.

Синтезом АТФ занимается молекулярная машина, которая называется АТФ-синтаза. Она состоит из двух частей. Первая погружена в мембрану называется F0 (см. рисунок). Она представляет собой протонный канал, то есть это дыра в мембране, по которой протон может попасть внутрь митохондрии, но попадает он внутрь с потерей энергии, которую улавливает вторая часть молекулярной машины, которая называется F1. Эта часть АТФ-синтазы торчит внутрь митохондрии и использует энергию "падающих" через F0 протонов для того, чтобы аденозиндифосфат соединился с фосфатом посредством макроэргической связи и образовал молекулу АТФ.

Рассмотрим, как АТФ-синтаза синтезирует АТФ. Оказывается, что прежде всего совершается работа механическая, так как для осуществления синтеза АТФ в АТФ-синтазе крутится белковая структура. Как устроена АТФ-синтаза?

Строение и принцип работы АТФ-синтетазы

Она состоит из двух частей – статора (на рисунке 9 помечено синим цветом), и ротора (обозначен красным). Статор состоит из трех альфа субъединиц и трех бета субъединиц – они занимаются химической частью работы: синтезом АТФ из АДФ и фосфата. В собранном состоянии все вместе эти субъединицы по форме напоминают слега приплюснутый шар 8 нм в высоту и 10 нм в диаметре.

К ним примыкает дельта субъединица, и все вместе эта система образует F1 субъединицу молекулярной машины. Здесь же есть опора, которая «якорит» всю систему в мембране. Как известно, мембрана сделана из фосфолипидов (на рисунке показаны желтым). Гидрофильные "головки" фосфолипидов обращены в водную поверхность, а гидрофобные "хвосты" погружены внутрь мембраны, и именно они препятствуют перемещению заряженных частиц через мембрану. Вращающаяся часть машины, ротор, состоит из гамма и эпсилон субъединиц. Эта конструкция погружена в структуру, сделанную из одинаковых белков, они обозначаются буквой с. Статор держится в мембране, а ротор крутится. И энергия протона используется на то, чтобы прокрутить ротор этой машины.

Молекулярная машина работает в обе стороны (так же как и катализаторы, которые проводят реакцию как в прямую, так и в обратную стороны). Если течет протонный ток с наружной мембраны внутрь, то синтезируется АТФ; если же протонного потенциала нет, но подать с внутренней стороны АТФ, то машина начнет «выкачивать» протоны, создавая протонный потенциал. При этом ротор также вращается.

Для того, чтобы доказать, что в АТФ синтазе вращается часть машины, F1 фрагмент перевернули, «пришили» к неподвижной подложке, а к гамма-субъединице навесили искусственным образом нить актина (длинный белок, который можно было увидеть в микроскоп, так как он был мечен флуоресцентной меткой). Затем подали к этой системе энергию в виде АТФ, и оказалось, что при наличии АТФ гамма субъединица начала крутиться. Все это сняли на пленку. Было видно, как крутится флуоресцентная метка на актиновом хвостике, и было показано, что действительно происходит вращение во время работы этой молекулярной машины (рис. 10).

Молекулярный ротор

Теперь разберем, как же крутится этот ротор; как работает электромотор в мембране клеток, как у бактерий, так и у митохондрий высших организмов. Если вы вспомните временную ось возникновения жизни, то увидите, что возникнуть этот мотор должен был более трех миллиардов лет назад.

Как же используется протонный ток, чтобы крутить мотор? Оказалось, что в статоре имеется протонный канал, т.е. такой белок, который образует проход для протона. Но этот канал не сплошной. Если бы был канал, который пронизывал всю мембрану насквозь, то из-за разницы потенциалов все протоны потекли бы внутрь митохондрии, и произошла бы деэнергетизация мембраны, т.е. она бы разрядилась. Но канал устроен очень хитро. Он состоит из двух половинок (полу-каналов), которые, к тому же, смещены одна относительно другой (рис. 1).

Принцип работы молекулярного ротора

Структура этой машины такова, что протон проваливается через полуканал с наружной стороны митохондриальной мембраны, но попасть внутрь митохондрии он не может. Сваливается протон на подставленную ему аминокислоту ротора и эту аминокислоту протонирует, то есть на аминокислоте появляется дополнительный положительный заряд. Затем, когда протонированная аминокислота на вращающемся роторе доедет до следующей половинки канала, ведущей уже внутрь митохондрии (а внутри протонов мало и, кроме того, там протон поджидают отрицательно заряженные ионы), то протон наконец "падает" внутрь и аминокислота освобождается от положительного заряда. Заряды в роторе и статоре расположены таким образом, что протонирование – депротонирование приводит к повороту машины. Таким образом, протон в два приема проваливается внутрь митохондрии, и за счет этого мотор проворачивается.

За объяснение ферментативного механизма, лежащего в основе синтеза АТФ, два исследователя получили Нобелевскую премию: Пол Д. Бойер, США и Джон Э. Уолкер, Великобритания (Нобелевская премия 1997 года).

Было рассказано, как мотор крутится, но не было объяснено, почему синтезируется АТФ. Сейчас подробно мы на этом останавливаться не будем, но вкратце, объяснить это можно следующим образом. Представим АТФ в таком виде: АТФ=АДФ~Ф. Собственно, почему при разрыве этой связи выделяется большое количество энергии? При разрыве образуется отрицательно заряженный фосфат, который гидратируется (покрывается «шубой» из молекул воды). Как вы помните, вода – это диполь (кислород имеет частично отрицательный заряд, а два водорода - положительный). И за счет гидратирования эта энергия и получается. Но если синтез АТФ идет в той среде, где воды нет, т.е. в гидрофобной среде, то макроэргической эта реакция не является. Показано, что когда происходит образование ковалентной связи между фосфатными группами молекул АДФ и Ф, ферменту практически не требуется энергии. Реакции синтеза и гидролиза ATP в каталитическом центре фермента активно идут при отсутствии внешнего источника энергии. Условия, в которых находятся молекулы АДФ и Ф в каталитическом центре, существенно отличаются от условий протекания реакции в водной среде, благодаря чему образование молекулы АТФ в активном центре фермента может происходить энергетически "бесплатно". Энергия "падающих" протонов тратится потом на то, чтобы «выпихнуть» вон АТФ, отцепить его от каталитической субъединицы.

 Таким образом, за счет электрохимического потенциала на внутренней мембране митохондрий внутри клетки или митохондрий совершается механическая работа, сопряженная с химическим синтезом.

На рисунке виден срез митохондрии (рис. 12). Внутри содержится матрикс и выросты (складки) – кристы, на которых и расположена АТФ-синтаза. Зачем нужны складки? Чтобы увеличить площадь поверхности. Количество складок внутри митохондрий зависит от того, насколько интенсивно ей приходится работать, сколько энергии нужно клетке. Митохондрии в клетках печени имеют гораздо меньше крист, чем, например, в клетках сердца.

Строение митохондрии

В хлоропластах происходит точно такой же процесс синтеза АТФ, также работает АТФ-синтаза, как и в митохондриях, но источником протонного потенциала является уловленная энергия света. Там тоже есть складки, они называются тилакоидами. Только в хлоропластах все как бы вывернуто наизнанку. То есть протоны за счет энергии света накапливаются снаружи этих образований.

ДВИГАТЕЛЬ БАКТЕРИЙ

Перейдем к работе следующего молекулярного мотора – жгутика у бактерии.

Известно, что не все, но некоторые бактерии могут двигаться. Для того, чтобы двигаться, они вертят хвостом, т.е. жгутиком. Если жгутиков несколько, то во время вращения они сплетаются в единый жгут, и вращаются, двигая бактерию, примерно как лопасти у катера (рис. 13).

Способы движения бактерии с помощью жгутиков

Жгутик очень маленький, в световой микроскоп его трудно увидеть. Для того, чтобы проверить, действительно ли жгутик вращается при движении бактерии, бактериальную клетку за жгутик прикрепили к стеклу (рис. 14). В раствор добавили вещество, которое она любит, например, сахар, и она начала вертеться, потому что она явно хотела добраться до сахара, если не добавляли, то она вела себя более спокойно.

Для того, чтобы жгутик вращался, в его основании находится так называемое базальное тело, которое представляет собой электромотор (рис. 15). Его задача заключается в том, чтобы крутить жгутик. На рисунке изображена мембрана бактериальной клетки (желтая), и части мотора статор (синий) и ротор (зеленый). К ротору прикручен жгутик. Пока неизвестно, как именно передается движение, но в этой молекулярной машине есть свои подшипники, своя молекулярная смазка, и есть белок, в котором, также как и в АТФ-синтазе, имеются два протонных полуканала, смещенных друг относительно друга. И принцип вращения такой же: зарядка-перезарядка группы COOH в аминокислотах. Число протонов, которые должны «провалиться» в канал за время одной прокрутки жгутика,- порядка тысячи; остальные параметры приведены ниже

Принцип работы жгутика бактерии

Характеристики работы жгутика бактерии

Вот микрофотография жгутика и молекулярного мотора в основании этого жгутика.

Микрофотография жгутика и молекулярного мотора

В лекции использованы рисунки из Соросовского образовательного журнала.

 

ЛИТЕРАТУРА ПО ТЕМЕ ЛЕКЦИИ:

  1. Соросовский образовательный журнал journal.issep.rssi.ru
  2. Скулачев В.П. Законы биоэнергетики// СОЖ 1997, №1, с. 9-14.
  3. Скулачев В.П. Электродвигатель бактерий. // СОЖ 1998, №9, с. 2-7.
  4. Виноградов А.Д. Преобразование энергии в митохондриях // СОЖ 1999, №9, с. 11-19.
  5. Тихонов А.Н.Молекулярные преобразователи энергии.// СОЖ. 1997, № 7, с. 10-17.
  6. Тихонов А.Н. Молекулярные моторы. Часть 1. Вращающиеся моторы живой клетки // СОЖ. 1999, №6, с. 8-16
  7. В.П.Скулачев Рассказы о биоэнергетике. Серия "Эврика". М. 1982.

Более подробно

  1. Уайт А., Хендлер Ф., Смит Р. и др. Основы биохимии. М.: Мир, 1981.
  2. Скулачев В.П. Аккумуляция энергии в клетке. М.: Наука, 1969.
  3. Скулачев В.П. Мембранные преобразователи энергии. М.: Высш. шк., 1989.
  4. Скулачев В.П. Энергетика биологических мембран. М.: Наука, 1989.
  5. Албертс Б., Брей Д., Льюис Дж. и др. Молекулярная биология клетки. 2-е изд. М.: Мир, 1994. Т. 1.
  6. Николс Д.Д. Биоэнергетика: Введение в хемиосмотическую теорию. М.: Мир, 1985.
Назад:
Лекция №2. Основные этапы развития биосферы на Земле
Далее:
Лекция №4. Строение биополимеров

наверх | на главную
 Discuss it
  • Anonymous — Наследование гуппы крови (анка пулеметчица [212.176.89.3], 25.02.2005 12:22:10) #
    Ну, ты ,чувак-ништяк!
     
    Ответить
    • Anonymous — Наследование гуппы крови (Владимир [213.189.224.130], 06.08.2005 15:17:13) #
      Очень интересная и поучительная лекция. Я сам изучал генетику и биотехнологию и считаю, что лекция представлена на высшем уровне. С уважением, Владимир
       
      Ответить
      • Anonymous — Наследование группы крови (Марта [217.106.116.207], 15.11.2005 16:36:15) #
        Очень интересная лекция. Я давно интересовалась этим, т.к. у моей дочери резус-фактор отрицательный, хотя и у меня и у мужа - положительный. Теперь все стало понятно. Спасибо за просвещение.
         
        Ответить
        • Anonymous — Наследование гуппы крови (Екатерина [217.175.23.48], 18.04.2006 16:08:33) #
          Материал не только интересный, но и доступный для понимания даже школьнику младшего класса. Я интересуюсь этой темой с тех пор, как мой отец (у которого, как и у моей мамы резус положительный, а у меня, к сожалению, получился отрицательный) сказал мне, что из-за этого я не его дочь, обвинил мою мать во всех смертных грехах и ушел от нас. Так что, дорогой папа, ты глубоко заблуждаешься. Ты не прав!!!
           
          Ответить
          • Anonymous — Наследование гуппы крови (Светлана [212.82.209.66], 02.06.2006 12:39:37) #
            Огромное Вам человеческое спасибо за то, что возвращаете людям смысл жизни, счастье и радость в семьи!!! Если бы у нас было меньше глупых врачей(особенно в роддомах)-как бы здорово всем жилось!
             
            Ответить
            • Anonymous — Наследование гуппы крови (Хз [217.24.162.57], 03.06.2006 22:04:22) #
              Почему такие слащавые отзывы то? Не иначе как Сорос уже глубоко в гены въелся ;)
               
              Ответить
              • Anonymous — Уж какие есть... (bioeditor [194.85.83.35], 03.06.2006 22:16:22) #
                За что ругать-то?
                 
                Ответить
                • Anonymous — ни о чем (agent [62.213.25.210], 21.09.2006 00:06:14) #
                  какие красивые шарики, цепочки, жгутики и шифровка тоже ничего :-))
                   
                  Ответить
                  • Anonymous — Наследование группы крови (lina [83.237.241.132], 08.12.2006 18:19:42) #
                    Меня сегодня студентка спросила на занятии по КСЕ, за что отвечает этот резус-фактор? Для чего он нужен в организме человека? Раз 15% людей без него обходятся, то выходит, это что-то лишнее?
                     
                    Ответить
                    • Anonymous — Ответ. (bioeditor [194.85.83.35], 08.12.2006 20:14:27) #
                      Прежде всего надо знать, что это белок, который может вызвать резус-конфликт между матерью и плодом и при переливании крови - именно поэтому надо ЗНАТЬ свой резус-фактор. Вопрос о том, какую роль этот белок выполняет в организме, является куда более интересным - я попробую найти ответ и поместить его здесь.
                       
                      Ответить
                      • Anonymous — Наследование группы крови (Петр [10.10.80.110], 09.12.2006 19:18:30) #
                        Я что-то понять не могу где у АТФ-синтазы Fo, а где F1 ?
                         
                        Ответить
                        • Anonymous — АТФ-синтаза (С.А. [213.141.159.176], 13.12.2006 12:56:57) #
                          F0 - это та часть, которая формирует протонный канал, F1 - это "шляпка" из субъединиц альфа-и бета, которые осуществляют синтез АТФ. Обозначения указаны на схеме с АТФ-синтазой галобактерий (рис. 8)
                           
                          Ответить
                          • Anonymous — наследование групп крови (наталья [85.91.110.98], 13.11.2007 16:10:38) #
                            очень интересно, спасибо
                             
                            Ответить
                            • Anonymous — группы крови и резус фактор (Ольга [62.221.65.205], 21.03.2008 21:00:50) #
                              Можно уточнить информацию о резусе. В течении жизни меняется резус-фактор,в часности у женщин во время нескольких беременостей
                               
                              Ответить
                              • Anonymous — резус-фактор (ОТВЕТ [213.141.159.252], 23.03.2008 19:53:40) #
                                Резус фактор детерминирован генетически, от условий жизни не зависит, определяется в момент зачатия (т.е. формирования диплоидного генома зиготы из двух родительских гаплоидных геномов) и затем не меняется. Могут меняться результаты анализа из-за технических ошибок медиков или лаборантов.
                                 
                                Ответить
                                • Anonymous — резус-фактор (ОТВЕТ [194.67.85.194], 26.03.2008 20:26:42) #
                                  Во время нескольких беременностей у резус-отрицательной матери при резус-положительном плоде изменяется не резус-фактор, а уровень антител к нему. За уровнем антител у беременных при возможности резус-конфликта следят в женской консультации. Существует специальное лечение для профилактики повышения антител и развития гемолитической желтухи у новорожденных.
                                   
                                  Ответить
                                  • Anonymous — опечатка (666 [10.55.116.232], 07.12.2008 18:36:49) #
                                    "под действием антител к БЕЛАМ"
                                     
                                    Ответить
                                    • Anonymous — Спасибо! (Света [193.19.83.13], 27.05.2009 00:47:56) #
                                      Замечательная лекция, спасибо! Смогла с её помощью отстраниться от мелочей и за деревьями лес увидеть=))
                                       
                                      Ответить
                                      • Anonymous — наследование группы крови (снежана [79.105.248.242], 06.11.2009 08:12:07) #
                                        я получила ответы на свои вопросы. спасибо.
                                         
                                        Ответить
                                        • Anonymous — Резус-фактор (Татьяна [ip-83-149-3-196.nwgsm.ru], 31.01.2011 15:04:32) #
                                          У моего мужа, до армии резус был отрицательный, сейчас ему 24 и у него положительный резус. Такое возможно? Или это ошибка?
                                           
                                          Ответить
                                          • Anonymous — RE: (Sinister [24-215.5-85.cust.bluewin.ch / 85.5.215.24], 11.05.2013 23:42:32) #
                                            Военные эксперименты.
                                             
                                            Ответить
                                          Оставить свой комментарий